PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01476.1.p
Common NameEUGRSUZ_K01476, LOC104425247
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 420aa    MW: 45984.7 Da    PI: 7.481
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01476.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.24.3e-3446100155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprl+Wtp+LHerFveav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Eucgr.K01476.1.p  46 KPRLKWTPDLHERFVEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 100
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.84943103IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-3244101IPR009057Homeodomain-like
SuperFamilySSF466894.84E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-2346101IPR006447Myb domain, plants
PfamPF002496.5E-104899IPR001005SANT/Myb domain
PfamPF143791.4E-25148193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MYHHNQHLGK NISPPSRMPI PSDRHMFIQG GNGPGDSGLV LSTDAKPRLK WTPDLHERFV  60
EAVNQLGGAD KATPKTVMKL MGIPGLTLYH LKSHLQKYRL SKNLHGQANS GNNKIGTVAV  120
GGDRVPETNG SHVHNLNIVP QTNKNLPFSE ALQMQIEVQR RLHEQLEVQR HLQLRIEAQG  180
KYLQSVLEKA QETLGRQNVG SASLEATKLQ LSELVSKVST QSLNSAFPDL KELQGLCAQQ  240
IQTNPPTDCS VDSCLTSCEG SHKDQEIHNN GIGLRPYSGG SVLLDPKGIT DEPRTEKIEF  300
KWGGDLKEDR MFLSYGVKEM ERSFPGGLGQ GHLSMSIGLE GGLGCSEVKN KAKEVGGSVN  360
FLERLHSRAD SVNMDSNQRS CGNQLHYFEA KLDLNAREET DVASSGKQFD LNGNGFGWG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01476.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036186.10.0PREDICTED: uncharacterized protein LOC104425247 isoform X1
TrEMBLA0A059A1W60.0A0A059A1W6_EUCGR; Uncharacterized protein
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-152G2-like family protein